MURF3 (Tripartite Motif-containing Protein 54, Muscle-specific RING Finger Protein, MuRF, Muscle-specific RING Finger Protein 3, MuRF-3, MuRF3, RING Finger Protein 30, MURF, TRIM54, RNF30)

Größe

£685.00

SKU:: 130011
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa186-255 from human TRIM54 (NP_115935) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May bind and stabilize microtubules during myotubes formation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PILASQNTKIIDSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.