MUC5AC (Mucin-5AC, MUC-5AC, Gastric Mucin, Lewis B Blood Group Antigen, LeB, Major Airway Glycoprotein, Mucin-5 Subtype AC, Tracheobronchial, Tracheobronchial Mucin, TBM, MUC5)

Größe

£685.00

SKU:: 130002
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa351-450 from human MUC5AC (XP_495860) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2H7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Mucin 5AC is expressed and secreted from surface mucous cells and is expressed in normal endocervical epithelia, small intestine, Lewis Type 1 gastric cells and gastric metaplasia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.