MTAP (methylthioadenosine phosphorylase, 5'-methylthioadenosine phosphorylase, c86fus, MSAP, MTAPase, MTA Phosphorylase, S-methyl-5'-thioadenosine Phosphorylase)

Größe

£685.00

SKU:: 129952
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-154 from human MTAP (AAH18625) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.