129929-ML650
MSK1 (Ribosomal Protein S6 Kinase alpha-5, S6K-alpha-5, 90kD Ribosomal Protein S6 Kinase 5, Nuclear Mitogen- and Stress-activated Protein Kinase 1, RSK-like Protein Kinase, RSKL, RPS6KA5) (MaxLight 650)
Größe
£914.00
- SKU:
- 129929-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa271-370 from RPS6KA5 (AAH17187) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. MSK1 is a dual kinase domain protein that acts downstream of the ERK1/2 and p38 MAPK signalling pathways. MSK1 phosphorylate the transcription factors CREB and ATF1, and the chromatin proteins histone H3 and HMGN1 in response to either mitogenic stimulation or cellular stress. MSK1 activity is tightly regulated in cells, and activation requires its phosphorylation by either ERK1/2 or p38alpha. This result in activation of the C-terminal kinase domain, which then phosphorylates further sites in MSK1, leading to the activation of the N-terminal kinase domain and phosphorylation of substrates. The protein contains two complete nonidentical protein kinase domains. The protein is widely expressed in human brain, heart, and placenta. Human MSK1 gene is mapped to chromosomal region 14q31-q32.1. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ILKSEPPYPQEMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice