MSI1 (Musashi-1, Musashi 1, RNA-binding Protein Musashi Homolog 1) (APC)

Größe

£934.00

SKU:: 129923-APC
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human MSI1, aa1-362 (NP_002433.1).
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Musashi 1, a neural RNA-binding protein, plays an important role in regulating cell differentiation in precursor cells. Musashi 1 (Msi-1) has been shown to increase the accumulation of tau isoforms in intracellular inclusions in dementia and Parkinson's. The presence of Msi-1 in a significant percentage of neurons containing cytoplasmic inclusions in 2 other neurodegenerative diseases Alzheimer's disease and Pick disease suggests that it may play a role in the pathogenesis of these neurodegenerative disorders. Musashi 1 has also been detected in human tumor tissues such as gliomas and melanomas, suggesting its involvement in cancer development. Msi-1 also appears to play be an vital role in the development of several types of carcinoma such as human hepatoma, and may be a useful molecular marker for tumor detection. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice