129921
MSI1 (Musashi-1, Musashi 1, RNA-binding Protein Musashi Homolog 1)
Größe
£685.00
- SKU:
- 129921
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human MSI1, aa1-362 (NP_002433.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Musashi 1, a neural RNA-binding protein, plays an important role in regulating cell differentiation in precursor cells. Musashi 1 (Msi-1) has been shown to increase the accumulation of tau isoforms in intracellular inclusions in dementia and Parkinson's. The presence of Msi-1 in a significant percentage of neurons containing cytoplasmic inclusions in 2 other neurodegenerative diseases Alzheimer's disease and Pick disease suggests that it may play a role in the pathogenesis of these neurodegenerative disorders. Musashi 1 has also been detected in human tumor tissues such as gliomas and melanomas, suggesting its involvement in cancer development. Msi-1 also appears to play be an vital role in the development of several types of carcinoma such as human hepatoma, and may be a useful molecular marker for tumor detection. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice