MSH6 (DNA Mismatch Repair Protein Msh6, hMSH6, G/T Mismatch-binding Protein, GTBP, GTMBP, MutS-alpha 160kD Subunit, p160, GTBP)

Größe

£685.00

SKU:: 129920
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa931-1030 from human MSH6 (NP_000170) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The MSH6 gene located on chromosome 2p16 is one of the mismatch-repair genes involved in hereditary nonpolyposis colorectal cancer (HNPCC). It performs other functions in the cell, like binding to damaged DNA to initiate events that result in damage-induced cytotoxicity. It shares five conserved protein domains (designated I-V) in common with bacterial MutS. However unlike bacterial MutS or Msh2, Msh6 has an additional evolutionarily conserved region preceding domain I, comprised of from 100-more than 600aa, depending on the organism. These N-Terminal Regions (NTRs) of Msh6 contain short, conserved PIP (PCNA interacting protein) boxes near the N-terminus that interact with PCNA, the sliding clamp that participates in both DNA replication and DNA mismatch repair. It forms a heterodimer with MSH2 and is also a part of the BRCA1-associated genome surveillance complex (BASC). The pathological role of Msh6 has also been identified in endometrial cancer. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice