129900
MRS2 (Magnesium Transporter MRS2 Homolog, Mitochondrial, MRS2-like Protein, HPT, MRS2L, MGC78523)
Größe
£685.00
- SKU:
- 129900
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-118 from human MRS2L with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1E2
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- MRS2 is magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice