MRPL42 (39S Ribosomal Protein L42, Mitochondrial, L42mt, MRP-L42, 28S Ribosomal Protein S32, Mitochondrial, MRP-S32, S32mt, 39S Ribosomal Protein L31, Mitochondrial, L31mt, MRP-L31, MRPL31, MRPS32, RPML31, HSPC204, PTD007)

Größe

£760.00

SKU:: 129869
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human MRPL42, aa1-142 (NP_054769.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins. Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.