129851-APC

MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (APC)

Größe

£927.00

SKU:: 129851-APC
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa73-173 from human MRLC2 (NP_291024) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B22
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]). Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.