129821-PE

MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (PE)

Größe

£914.00

SKU:: 129821-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa79-178 from human MPP5 (NP_071919) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: May play a role in tight junctions biogenesis and in the establishment of cell polarity in epithelial cells. May modulate SC6A1/GAT1-mediated GABA uptake by stabilizing the transporter. Required for localization of EZR to the apical membrane of parietal cells and may play a role in the dynamic remodeling of the apical cytoskeleton. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKAS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.