MOX1 (Homeobox Protein MOX-1, Mesenchyme Homeobox 1, MEOX1)

Größe

£685.00

SKU:: 129802
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein. corresponding to aa165-252 from human MEOX1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Meox1 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. This protein may play a role in the molecular signaling network regulating somite development. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.