MOGAT3 (2-acylglycerol O-acyltransferase 3, Acyl-CoA:monoacylglycerol Acyltransferase 3, MGAT3, Diacylglycerol O-acyltransferase Candidate 7, hDC7, Diacylglycerol Acyltransferase 2-like Protein 7, Monoacylglycerol O-acyltransferase 3, DC7, DGAT2L7, UNQ9383/PRO34208, MGC119203, MGC119204)

Größe

£685.00

SKU:: 129791
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa59-108 from human MOGAT3 (NP_835470) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Sandwich ELISA: The detection limit is ~10ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.