MMP3 (Stromelysin-1, SL-1, Matrix Metalloproteinase-3, MMP-3, Transin-1, STMY1, MGC126102, MGC126103, MGC126104)

Größe

£685.00

SKU:: 129763
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-131 from human MMP3 (NP_002413) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Proteins of the matrix metalloprotease family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling as well as disease processes such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.