129756-ML490
MMP23B (Matrix Metalloproteinase-23, MMP-23, Femalysin, MIFR-1, Matrix Metalloproteinase-21, MMP-21, Matrix Metalloproteinase-22, MMP-22, MMP23A, MMP21, MMP23B, MMP22) (MaxLight 490)
Größe
£914.00
- SKU:
- 129756-ML490
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa241-340 from human MMP23B with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 200
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. MMP23A and MMP23B, two Metallopeptidase type proteases, are type II membrane-anchored zymogens that are proteolytically processed at a conserved motif and converted into secretory and mature enzymes. The proteins contain prepro, catalytic, cysteine-rich, interleukin-1 receptor-related and proline-rich domains. The MMP23A and MMP23B genes have been reported to express multiple mRNAs, some of which are derived by alternative splicing. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice