129756-BIOTIN
MMP23B (Matrix Metalloproteinase-23, MMP-23, Femalysin, MIFR-1, Matrix Metalloproteinase-21, MMP-21, Matrix Metalloproteinase-22, MMP-22, MMP23A, MMP21, MMP23B, MMP22) (Biotin)
Größe
£914.00
- SKU:
- 129756-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa241-340 from human MMP23B with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 200
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
- Weitere Details:
- MMP23A and MMP23B, two Metallopeptidase type proteases, are type II membrane-anchored zymogens that are proteolytically processed at a conserved motif and converted into secretory and mature enzymes. The proteins contain prepro, catalytic, cysteine-rich, interleukin-1 receptor-related and proline-rich domains. The MMP23A and MMP23B genes have been reported to express multiple mRNAs, some of which are derived by alternative splicing. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice