MMP1 (Interstitial Collagenase, Fibroblast Collagenase, Matrix Metalloproteinase-1, MMP-1, CLG)

Größe

£685.00

SKU:: 129742
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa370-469 from human MMP1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: MMP1 is a Metallopeptidase M10A type protease. MMP1, also known as collagenase, is a secreted protein. Collagenase is the only enzyme able to initiate breakdown of the interstitial collagens, types I, II, and III. The fact that the collagens are the most abundant proteins in the body means that collagenase plays a key role in the remodeling that occurs constantly in both normal and diseased conditions. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.