MIB1 (E3 Ubiquitin-protein Ligase MIB1, DAPK-interacting Protein 1, DIP-1, Mind Bomb Homolog 1, Zinc Finger ZZ Type with Ankyrin Repeat Domain Protein 2, DIP1, KIAA1323, ZZANK2, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZZ6)

Größe

£685.00

SKU:: 129672
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa909-1007 from human MIB1 (NP_065825) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.