129672-BIOTIN

MIB1 (E3 Ubiquitin-protein Ligase MIB1, DAPK-interacting Protein 1, DIP-1, Mind Bomb Homolog 1, Zinc Finger ZZ Type with Ankyrin Repeat Domain Protein 2, DIP1, KIAA1323, ZZANK2, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZZ6) (Biotin)

Größe

£914.00

SKU:: 129672-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa909-1007 from human MIB1 (NP_065825) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice