MGMT (O-6-Methylguanine DNA Methyltransferase, 6-O-Methylguanine DNA Methyltransferase, Methylated DNA Protein Cysteine Methyltransferase, Methylguanine DNA Methyltransferase, O-6-Methylguanine DNA Alkyltransferase)

Größe

£685.00

SKU:: 129656
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human MGMT, aa1-207 (NP_002403.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. This protein repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the protein is irreversibly inactivated. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.