MGEA5 (Bifunctional Protein NCOAT, Meningioma-expressed Antigen 5, Nuclear Cytoplasmic O-GlcNAcase and Acetyltransferase, HEXC, KIAA0679, MEA5, FLJ11229, FLJ23355)

Größe

£685.00

SKU:: 129653
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa823-916 from human MGEA5 (NP_036347) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Cleaves GlcNAc but not GalNAc from glycopeptides. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc. Possesses hyaluronidase activity. Acetylates 'Lys-8' of histone H4 and 'Lys-14' of histone H3. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILGRSL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.