129617-ML490
MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) (MaxLight 490)
Größe
£914.00
- SKU:
- 129617-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa430-532 from human MGAT3 (NP_002400) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. MGAT3 (N-acetylglucosaminyltransferase III) transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Expression of this gene may be controlled by a multiple-promoter system. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice