129611
MFNG (Beta-1,3-N-acetylglucosaminyltransferase Manic Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase)
Größe
£685.00
- SKU:
- 129611
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human MFNG, aa1-321 (NP_002396.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- MFNG is a 52-55kD member of the glucosyltransferase 31 family. It is a Golgi membrane protein that transfers N-acetylglucosamine to an O-linked fucose residue on Notch. Activity on Notch increases Delta-1 induced signaling while suppressing Jagged-1 signaling. MFNG is found in fetal pancreatic endocrine progenitor cells and immature ventricular zone neurons. Human MFNG is a 321aa type II transmembrane protein. It contains a short 7aa cytoplasmic region, plus a 294aa luminal domain (aa28-321). There are two potential splice variants, one that shows a 15aa substitution for aa104-321, and another that contains a three aa substitution for aa86-102. Over aa37-321, human MFNG shares 85% aa identity with mouse MFNG. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice