METTL2 (METTL2A, Methyltransferase-like Protein 2A, HSPC266, FLJ11350, FLJ12760, PSENIP1)

Größe

£685.00

SKU:: 129599
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa41-109 from human METTL2 (NP_060866) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Probable S-adenosyl-L-methionine-dependent methyltransferase that mediates 3-methylcytidine modification of some tRNAs. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICAD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.