MELK (Maternal Embryonic Leucine Zipper Kinase, hMELK, Protein Kinase PK38, hPK38, KIAA0175)

Größe

£685.00

SKU:: 129578
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa550-650 from human MELK with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D8
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Maternal embryonic leucine zipper kinase (MELK) is a member of the Snf1/AMPK serine/threonine kinase family. Members of this family provide protection to cells against environmental stress and may control biosynthetic pathways of carbon metabolism. MELK is expressed in a spatially and temporally specific pattern during mammalian embryogenesis. The strongest expression was detected during maturation of oocytes and preimplantation development. Studies also indicated that MELK functions as a cancer-specific protein kinase, and down-regulation of MELK results in growth suppression of breast cancer cells. In addition, it was demonstrated that MELK physically interacts and phosphorylates a long isoform of Bcl-G (Bcl-GL), a pro- apoptotic member of the Bcl-2 family, to affect mammary carcinogenesis through inhibition of the pro-apoptotic function of Bcl-GL. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice