129572-ML490
Melanin Concentrating Hormone Receptor 1 (MCH Receptor 1, MCHR1, MCH-R1, MCHR-1, MCH1R, MCH-1R, MCHR, G-protein Coupled Receptor 24, GPR24, MGC32129, Somatostatin Receptor-like Protein, SLC1, SLC-1) (MaxLight 490)
Größe
£914.00
- SKU:
- 129572-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa14-113 from human GPR24 (AAH01736) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3D7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. MCHR1 is a Melanin-Concentrating Hormone Receptor that binds MCH to regulate nutritional homeostasis, including feeding and body adiposity. The receptor also functions in sensory perception and integration of smell and gustatory inputs, as well as in emotion and memory. MCHR1 has been reported in brain, particularly in the frontal cortex and hypothalamus, as well as in adrenal, intestine, and skin. ESTs have been isolated from brain and nerve libraries. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice