129555-BIOTIN
MEF2A (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2) (Biotin)
Größe
£914.00
- SKU:
- 129555-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa71-170 from human MEF2A (AAH13437) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1A10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- MEF2A is a member of the myocyte enhancer factor-2 (MEF2) family of transcription factors, and other members include MEF2B, MEF2C and MEF2D. These DNA-binding proteins are important transcription factors in both the maintenance and induction of the muscle differentiated phenotype. These factors bind DNA as homo- and heterodimers but can also form protein-protein interactions with the thyroid hormone receptor. MEF2A was initially identified as a muscle-specific gene, but was later shown to be highly expressed in the endothelium of coronary arteries. Human MEF2A gene is located in chromosomal 15q26 region. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice