MED4 (ARC36, DRIP36, VDRIP, Mediator of RNA Polymerase II Transcription Subunit 4, Activator-recruited Cofactor 36kD Component, Mediator Complex Subunit 4, TRAP/SMCC/PC2 Subunit p36 Subunit, Vitamin D3 Receptor-interacting Protein Complex 36kD Component)

Größe

£685.00

SKU:: 129546
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-271 from human MED4 (AAH05189) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II (see MIM 180660)-transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (summary by Sato et al., 2004 [PubMed 15175163]). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.