MECOM (MDS1 and EVI1 Complex Locus Protein MDS1, Myelodysplasia Syndrome 1 Protein, Myelodysplasia Syndrome-associated Protein 1, MDS1)

Größe

£685.00

SKU:: 129531
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa80-169 from human MDS1 (NP_004982) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: A chromosomal aberration involving MDS1 is found in a form of acute myeloid leukemia (AML). Translocation t(3;21) with AML1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.