MDR1 (Multidrug Resistance Protein 1, ABC20, ATP-binding Cassette Sub-family B Member 1, ABCB1, CD243, CLCS, GP170, MGC163296, P-glycoprotein 1, P-GP, PGY1, MGC163296)

Größe

£685.00

SKU:: 129526
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa620-710 from ABCB1 (NP_000918) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The Human multidrug resistance gene MDR1 encodes a membrane-bound protein, referred to as P-glycoprotein that acts as a pump to extrude toxins from cells. The 3' untranslated region (3'UTR) of the Human MDR1 mRNA is very AU-rich (70%). MDR1 is a member of the super family of ATP-binding cassette (ABC) transporters. MDR1 is a member of the MDR/TAP subfamily. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. It is expressed in Human liver, kidney, small intestine and brain. It is localized to Human chromosome 7q21.1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice