129526-BIOTIN
MDR1 (Multidrug Resistance Protein 1, ABC20, ATP-binding Cassette Sub-family B Member 1, ABCB1, CD243, CLCS, GP170, MGC163296, P-glycoprotein 1, P-GP, PGY1, MGC163296) (Biotin)
Größe
£914.00
- SKU:
- 129526-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa620-710 from ABCB1 (NP_000918) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- The Human multidrug resistance gene MDR1 encodes a membrane-bound protein, referred to as P-glycoprotein that acts as a pump to extrude toxins from cells. The 3' untranslated region (3'UTR) of the Human MDR1 mRNA is very AU-rich (70%). MDR1 is a member of the super family of ATP-binding cassette (ABC) transporters. MDR1 is a member of the MDR/TAP subfamily. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. It is expressed in Human liver, kidney, small intestine and brain. It is localized to Human chromosome 7q21.1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice