129496
MCM3AP (80kD MCM3-associated Protein, Protein GANP, GANP, KIAA0572, MAP80, FLJ44336, FLJ45306)
Größe
£685.00
- SKU:
- 129496
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-100 from MCM3AP (AAH13285) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1H3
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- MCM3AP is a 1980aa protein belonging to the SAC3 family and contains domains for MCM3-binding and RNA-primase activities. It is a potent natural inhibitor of the initiation of DNA replication whose action is mediated by interaction with MCM3. Interaction between MCM3 and MCM3AP is essential for nuclear localization and chromatin binding of MCM3AP. It limits DNA replication to once per cell cycle. MCM3AP is an acetyltransferase that acetylates MCM3. It also plays a role in B cell proliferation, differentiation and MCM3 nuclear localization. It is expressed mostly in germinal centers (GCs) of B cells. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice