MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2)

Größe

£685.00

SKU:: 129488
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa220-320 from MCF2L (AAH20208) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: MCF2L2 probably functions as a guanine nucleotide exchange factor. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCL* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.