MCCC1 (MCCA, Methylcrotonoyl-CoA Carboxylase Subunit alpha, Mitochondrial, 3-methylcrotonyl-CoA Carboxylase 1, 3-methylcrotonyl-CoA Carboxylase Biotin-containing Subunit, 3-methylcrotonyl-CoA:carbon Dioxide Ligase Subunit alpha, DKFZp686B20267, FLJ25545, MCC-B)

Größe

£685.00

SKU:: 129482
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa526-626 from human MCCC1 (NP_064551) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: MCCC1 is the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTFQVLGNLYSEGDCTYLKCSVNGVASKAKLIILENTIYLFSKEG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.