MBNL2 (MBLL, MBLL39, MLP1, Muscleblind-like Protein 2, Muscleblind-like Protein 1, Muscleblind-like Protein-like, Muscleblind-like Protein-like 39)

Größe

£685.00

SKU:: 129472
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-80 from MBNL2 (NP_659002) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene encodes a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein. Drosophila muscleblind is a gene required for photoreceptor differentiation. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.