129449-BIOTIN
MAST2 (Microtubule-associated Serine/Threonine-protein Kinase 2, KIAA0807, MAST205, FLJ39200, RP4-533D7.1) (Biotin)
Größe
£914.00
- SKU:
- 129449-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa688-792 from MAST2 (AAH15816) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins. Functions in a multi-protein complex in spermatid maturation. Regulates lipopolysaccharide-induced IL-12 synthesis in macrophages by forming a complex with TRAF6, resulting in the inhibition of TRAF6 NF-kappa-B activation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SASATALSLLIPSEHHTCSPLASPMSPHSQSSNPSSRDSSPRSMASPCGPFASTWVTPMSTPCTIWCGTWRMEVRPVRQGFVKVTSSPMSMGNLCMAWCTRRWWS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice