129443
MARVELD1 (MARVEL Domain-containing Protein 1, MRVLDC1, bA548K23.8, FLJ22343, FLJ23440, GB14, MARVD1, MGC4415, RP11-548K23.8)
Größe
£685.00
- SKU:
- 129443
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human MARVELD1, aa1-173 (NP_113672.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Microtubule-associated protein that exhibits cell cycle-dependent localization and can inhibit cell proliferation and migration. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice