129433-HRP

MARCH9 (E3 Ubiquitin-protein Ligase MARCH9, Membrane-associated RING Finger Protein 9, Membrane-associated RING-CH Protein IX, MARCH-IX, RING Finger Protein 179, RNF179, FLJ36578, MARCH-IX) (HRP)

Größe

£914.00

SKU:: 129433-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa240-346 from human MARCH9 (NP_612405) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: MARCH9 belongs to the membrane associated RING-CH (MARCH) family of genes which encode a novel group of RING-type ubiquitin E3 ligases. It is the first ubiquitin E3 ligase to control expression of the critical cell adhesion molecule ICAM-1. The expression of the protein causes ubiquitination and downregulation of ICAM-1. A short alternative transcript of MARCH9 lacking the RING-CH domain, termed MARCH9 RINGless, is shown to act as a positive regulator of MARCH9 activity. Overexpression of the protein, leads to downregulation of cell surface major histocompatibility complex (MHC) class I and CD4. Human MARCH9 gene maps to chromosome 12q14.1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice