MARCH7 (E3 Ubiquitin-protein Ligase MARCH7, Axotrophin, Membrane-associated RING Finger Protein 7, Membrane-associated RING-CH Protein VII, MARCH-VII, RING Finger Protein 177, AXOT, RNF177, DKFZp586F1122)

Größe

£685.00

SKU:: 129432
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa66-137 from human MARCH7 (NP_073737) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLSDSSWRHSQVPRSSSMVLGSFG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.