MARCH6 (E3 Ubiquitin-protein Ligase MARCH6, Doa10 Homolog, Membrane-associated RING Finger Protein 6, Membrane-associated RING-CH Protein VI, MARCH-VI, Protein TEB-4, RING Finger Protein 176, KIAA0597, RNF176, TEB4)

Größe

£685.00

SKU:: 129431
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-91 from MARCH6 (NP_005876) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: MARCH6 (Membrane associated RING finger protein 6) belongs to the MARCH family, which contains at least seven membrane associated RING-CH (MARCH)proteins. MARCH proteins are E3 ubiquitin ligases and are located to subcellular membranes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.