MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V)

Größe

£685.00

SKU:: 129430
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-95 from human MARCH5 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.