129430-BIOTIN

MARCH5 (RNF153, E3 Ubiquitin-protein Ligase MARCH5, Membrane-associated RING Finger Protein 5, Membrane-associated RING-CH Protein V, Mitochondrial Ubiquitin Ligase, RING Finger Protein 153, FLJ20445, MARCH-V) (Biotin)

Größe

£914.00

SKU:: 129430-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-95 from human MARCH5 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C3
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Weitere Details:: MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2; MIM 608507) and DRP1 (DNM1L; MIM 603850) (Nakamura et al., 2006 [PubMed 16936636]). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MPDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRLISK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.