MARCH2 (E3 Ubiquitin-protein Ligase MARCH2, Membrane-associated RING Finger Protein 2, Membrane-associated RING-CH Protein II, MARCH-II, RING Finger Protein 172, RNF172, HSPC240)

Größe

£685.00

SKU:: 129428
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-176 from human MARCH2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7F3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: MARCH2 is an E3 ubiquitin ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. MARCH2 may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. Applications: Suitable for use in ELISA and Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.