MAPK3 (Mitogen-activated Protein Kinase 3, MAPK 3, MAP Kinase 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, P44ERK1, p44-ERK1, P44MAPK, p44-MAPK, PRKM3, MGC20180)

Größe

£685.00

SKU:: 129404
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa279-379, from human MAPK3, (AAH13992) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: One of the major signaling pathways used by eukaryotic cells to translate extracellular signals into cellular responses is the MAP (mitogen-activated protein) kinase cascade. So far, four MAPK subgroups (ERK, ERK5, JNK and p38) have been identified in humans. ERK, extracellular signal-regulated kinases 1 and 2 are growth factor-sensitive serine/threonine kinases. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 25ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.