129404-BIOTIN
MAPK3 (Mitogen-activated Protein Kinase 3, MAPK 3, MAP Kinase 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, P44ERK1, p44-ERK1, P44MAPK, p44-MAPK, PRKM3, MGC20180) (Biotin)
Größe
£914.00
- SKU:
- 129404-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa279-379, from human MAPK3, (AAH13992) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3C9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- One of the major signaling pathways used by eukaryotic cells to translate extracellular signals into cellular responses is the MAP (mitogen-activated protein) kinase cascade. So far, four MAPK subgroups (ERK, ERK5, JNK and p38) have been identified in humans. ERK, extracellular signal-regulated kinases 1 and 2 are growth factor-sensitive serine/threonine kinases. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 25ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice