MAPK13 (Mitogen-activated Protein Kinase 13, MAPK 13, MAP Kinase 13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta, Stress-activated Protein Kinase 4, SAPK4, MGC99536)

Größe

£760.00

SKU:: 129400
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human MAPK13, aa1-538 (NP_002745.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: MAP kinase p38 delta, a MAPK type protein kinase, is an environmental stress- and inflammatory cytokine-induced kinase that is associated with the regulation of gene expression and cell proliferation. p38delta is phosphorylated by MEK3/MAP2K3 or MKK6/MAP2K6. Activated p38delta has been shown to phosphorylate ATF2, eEF2K, MBP and PHAS-1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.