129388-ML490
MAP4 (Microtubule-associated Protein 4, MAP-4, DKFZp779A1753, MGC8617) (MaxLight 490)
Größe
£914.00
- SKU:
- 129388-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-99 from human MAP4 (NP_112147.2) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 7C9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Microtubule-associated protein 4 (MAP4) is a ubiquitous non-neuronal microtubule-associated protein. This protein binds, polymerizes, and stabilizes microtubules and is thought to regulate microtubule dynamics during the cell cycle. p34cdc2 kinase phosphorylation of MAP4 appears to regulate the control of microtubule reorganization at mitosis (Ookata, 1997). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice