129370-ML550
MAP2K3 (Dual Specificity Mitogen-activated Protein Kinase Kinase 3, Mitogen-activated Protein Kinase Kinase 3, MAP Kinase Kinase 3, MAPKK 3, MKK3, MAPK/ERK Kinase 3, MEK 3, MEK3, PRKMK3, Stress-activated Protein Kinase Kinase 2, SAPK Kinase 2, SAPKK2, SAPKK-2, SKK2) (MaxLight 550)
Größe
£934.00
- SKU:
- 129370-ML550
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human MAP2K3, aa1-347 (NP_659731.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. MKK3 is a protein kinase that phosphorylates the p38 MAPK. Phosphorylation by MKK3 occurs on threonine and tyrosine residues and increases the activity of p38 to stimulate transcription factors ATF2 and Elk-1. MKK3, together with MKK6, serves as upstream regulators of p38 MAPK activation. A structural variant, MKK3b, has been identified that contains 29 more aa at its N-terminus. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice