129365-ML650
MAP2K1 (Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAPK/ERK Kinase 1, MEK1, MAPKK 1, MAPKK1, MEK 1, MKK1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, ERK Activator Kinase 1, PRKMK1) (MaxLight 650)
Größe
£914.00
- SKU:
- 129365-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa294-393, from human MAP2K1 (NP_002746) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. MEK1 is an integral component of the MAP kinase cascade that regulates cell growth and differentiation and this pathway also plays a key role in synaptic plasticity in brain. Activated MEK1 acts as a dual specificity kinase phosphorylating both a threonine and a tyrosine residue on MAP kinase. Conversely there also appears to be a feedback phosphorylation of MEK1 by MAP kinase. The sites on MEK1 that are phosphorylated by MAP kinase are Thr292 and Thr386. human MEK1 gene is localized on chromosomal region 15q22.1-q22.33. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice