MAP1S (BPY2IP1, C19orf5, MAP8, VCY2IP1, Microtubule-associated Protein 1S, BPY2-interacting Protein 1, Microtubule-associated Protein 8, Variable Charge Y Chromosome 2-interacting Protein 1, MAP1S Heavy Chain, MAP1S Light Chain, FLJ10669, MGC133087)

Größe

£685.00

SKU:: 129363
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa929-1027 from human MAP1S (NP_060644) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule-organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.